PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000353-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 114aa    MW: 12920.1 Da    PI: 4.336
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000353-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.98.4e-1265107145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ +T++E+ l+++  ++lG + W++Ia +++ gRt++++  +w 
    NNU_000353-RA  65 KLEFTEDEETLIARMYNLLGDR-WSLIAGRIP-GRTAEEIEKYWT 107
                      679*****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.40860114IPR017930Myb domain
SMARTSM007173.2E-964112IPR001005SANT/Myb domain
PfamPF002491.6E-1066107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-1367108IPR009057Homeodomain-like
SuperFamilySSF466894.45E-967110IPR009057Homeodomain-like
CDDcd001672.76E-867106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MCRKTEVCCL ISILSNVSAS MLLAIGMLLN FQGAWPIWIA PLTIPLWILG VLFDVCIEET  60
SQGSKLEFTE DEETLIARMY NLLGDRWSLI AGRIPGRTAE EIEKYWTSRY STSE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248700.11e-78PREDICTED: transcription factor TRY-like
TrEMBLB9MXY44e-29B9MXY4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s06470.11e-28(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.15e-18MYB_related family protein